Bioinformatics Prediction of Interaction Silver Nanoparticles on the Disulfide Bonds of HIV-1 Gp120 Protein

Silver nanoparticles have anti-HIV features in early stages of virus amplification. The two existing disulfide bonds in carboxyl half of the HIV-1 GP120, which cooperate in conjugation of CD4 receptor, interact with silver nanoparticles. Studies on protein disulfide bonds were done using Metal Detector Predicts V2.0 software. All Cys and His residues in amino acid sequences were identified. Protein denaturation decreases disulfide bonds when silver ions couple with sulfhydryl groups. CTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHC amino acid sequence in GP 120 plays a key role. Breaking this bond can alter spatial structure of the protein and prevents this part from connecting to CD4. Ultimately, nanosilver can prevent HIV from connecting to CD4.