To perceive the relationship between the emergences of antibiotics persistence, biofilm formation, and to study the role of silver nitrate in fighting these microbes, a total 50 clinical Klebsiella pneumonae isolates were collected from clinical sources and identified using genotypic identification by using specific primer (rpoB gene) from housekeeping genes. Detection of their biofilm-forming abilities were carried out. The eradication effect of silver nitrate to control bacterial persistence and reducing the biofilm-forming abilities were studied. We found that 40 isolate (80%) were biofilm-formers. From bacterial persisters, (75%) were biofilm-formers. Silver nitrate showed a great role to eradicate persister cells and inhibition of bacterial biofilm formation of clinical isolates of K. pneumoniae.
{"title":"Eradication of Klebsiella pneumoniae biofilms and persister cells using silver nitrate","authors":"Sarah N. Aziz, M. Marjani","doi":"10.48129/kjs.15153","DOIUrl":"https://doi.org/10.48129/kjs.15153","url":null,"abstract":"To perceive the relationship between the emergences of antibiotics persistence, biofilm formation, and to study the role of silver nitrate in fighting these microbes, a total 50 clinical Klebsiella pneumonae isolates were collected from clinical sources and identified using genotypic identification by using specific primer (rpoB gene) from housekeeping genes. Detection of their biofilm-forming abilities were carried out. The eradication effect of silver nitrate to control bacterial persistence and reducing the biofilm-forming abilities were studied. We found that 40 isolate (80%) were biofilm-formers. From bacterial persisters, (75%) were biofilm-formers. Silver nitrate showed a great role to eradicate persister cells and inhibition of bacterial biofilm formation of clinical isolates of K. pneumoniae.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"56 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-05-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"85684369","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
F. Rehman, A. Alamri, S. El-Hady, Hussein M. Harbi, M. F. Ullah, Saif-ur- Rehman
The soil conditions variability at site strongly influence ground motions during earthquakes. The disastrous earthquakes have shown that the local site conditions are the essential factors that impact lsurficial ground motions. In present study, local site effects are evaluated for ground motion acceleration and amplification at Bahrah. The town is situated on which is covered by quaternary alluvial wadi deposits. The ground motion time series are obtained through Spectral matching technique. is utilized to generate well matched ground motion time series based on the results of the PSHA and the deaggregation process. The ground motion time series and shallow Geophysical data are utilized to carry out One-dimensional simulation is carried out for equivalent linear seismic response analyses for soil layers. Results of One-dimensional site response analysis are interpolated to generate maps that account for ground motion accelerations and amplifications at top of the soil for selected spectral periods (PGA, 0.1, 0.2 and 2) for 475 years return period. The maps show the ground shaking rather than the probability of damage to buildings. The maximum values of amplification ranges upto 3.46 and acceleration upto 0.86 g. The undulation of bed rock topography and existence of deep soft sediments are reflected considerably on the results of the study area. The surface ground motion maps show that the seismic hazard level in Bahrah is moderate.
{"title":"Local Site effects for ground motion acceleration and amplification at Bahrah, Saudi Arabia.","authors":"F. Rehman, A. Alamri, S. El-Hady, Hussein M. Harbi, M. F. Ullah, Saif-ur- Rehman","doi":"10.48129/kjs.12349","DOIUrl":"https://doi.org/10.48129/kjs.12349","url":null,"abstract":"The soil conditions variability at site strongly influence ground motions during earthquakes. The disastrous earthquakes have shown that the local site conditions are the essential factors that impact lsurficial ground motions. In present study, local site effects are evaluated for ground motion acceleration and amplification at Bahrah. The town is situated on which is covered by quaternary alluvial wadi deposits. The ground motion time series are obtained through Spectral matching technique. is utilized to generate well matched ground motion time series based on the results of the PSHA and the deaggregation process. The ground motion time series and shallow Geophysical data are utilized to carry out One-dimensional simulation is carried out for equivalent linear seismic response analyses for soil layers. Results of One-dimensional site response analysis are interpolated to generate maps that account for ground motion accelerations and amplifications at top of the soil for selected spectral periods (PGA, 0.1, 0.2 and 2) for 475 years return period. The maps show the ground shaking rather than the probability of damage to buildings. The maximum values of amplification ranges upto 3.46 and acceleration upto 0.86 g. The undulation of bed rock topography and existence of deep soft sediments are reflected considerably on the results of the study area. The surface ground motion maps show that the seismic hazard level in Bahrah is moderate.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"36 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"74103355","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
The economical fabrication of one-dimensional dielectric reflectors using the hybrid sol-gel spin coating process is significant compared to sophisticated chemical and physical vapor deposition techniques. In this work, we opted for alternate layers of TiO2 and SiO2 films to fabricate near-infrared dielectric reflectors owing to their high refractive index contrast and easy tunability of the reflection window in the desired spectral range. X-ray diffraction (XRD) studies of the monolayer TiO2 and SiO2 confirmed the existence of anatase-TiO2 and amorphous-SiO2 phases, respectively. Spectroscopic ellipsometry investigation of TiO2 and SiO2 films revealed the refractive indices of 2.6 and 1.5, respectively. The field-emission scanning electron microscopy (FESEM) analyses evidenced the fabrication of 2.5 stacks/bilayers of TiO2/SiO2 (TiO2/SiO2)2.5S. The reflectance measurement demonstrated 100% reflection in the near-infrared region with its center wavelength of 833 nm. In addition, we have examined the water contact angle of various samples using the sessile drop technique, and 2.5 stacks-based reflector showed its lowest contact angle of 29.3o, which suggests its anti-fogging and self-cleaning applications.
{"title":"Transparent Dielectric TiO2/SiO2 Coatings for Thermal Shielding and Self-Cleaning Applications","authors":"Venkatesh Yepuri, D. R.S.","doi":"10.48129/kjs.17787","DOIUrl":"https://doi.org/10.48129/kjs.17787","url":null,"abstract":"The economical fabrication of one-dimensional dielectric reflectors using the hybrid sol-gel spin coating process is significant compared to sophisticated chemical and physical vapor deposition techniques. In this work, we opted for alternate layers of TiO2 and SiO2 films to fabricate near-infrared dielectric reflectors owing to their high refractive index contrast and easy tunability of the reflection window in the desired spectral range. X-ray diffraction (XRD) studies of the monolayer TiO2 and SiO2 confirmed the existence of anatase-TiO2 and amorphous-SiO2 phases, respectively. Spectroscopic ellipsometry investigation of TiO2 and SiO2 films revealed the refractive indices of 2.6 and 1.5, respectively. The field-emission scanning electron microscopy (FESEM) analyses evidenced the fabrication of 2.5 stacks/bilayers of TiO2/SiO2 (TiO2/SiO2)2.5S. The reflectance measurement demonstrated 100% reflection in the near-infrared region with its center wavelength of 833 nm. In addition, we have examined the water contact angle of various samples using the sessile drop technique, and 2.5 stacks-based reflector showed its lowest contact angle of 29.3o, which suggests its anti-fogging and self-cleaning applications.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"39 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"76313409","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
In this paper, we characterize the classes (L,Lk) , (Lk,L) and (L∞,Lk) , 1 ≤ k < ∞, of all four dimensional infinite matrices, where Lk and L∞ are the spaces of all absolutely k-summable and bounded double sequences, respectively. Using them, we establish some relations between N, pn, qn and N, p′ n, q′n k summability methods which extend some results of Bosanquet (1950), Sarıg¨ol (1993), Sarıg¨ol and Bor (1995), and Sunouchi (1949) to double summability methods, and give a relation between single and double summability methods.
{"title":"Four dimensional matrix mappings and applications","authors":"Mehmet Ali Sarıg¨ol","doi":"10.48129/kjs.17649","DOIUrl":"https://doi.org/10.48129/kjs.17649","url":null,"abstract":"In this paper, we characterize the classes (L,Lk) , (Lk,L) and (L∞,Lk) , 1 ≤ k < ∞, of all four dimensional infinite matrices, where Lk and L∞ are the spaces of all absolutely k-summable and bounded double sequences, respectively. Using them, we establish some relations between N, pn, qn and N, p′ n, q′n k summability methods which extend some results of Bosanquet (1950), Sarıg¨ol (1993), Sarıg¨ol and Bor (1995), and Sunouchi (1949) to double summability methods, and give a relation between single and double summability methods.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"1 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"82832316","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
An anodizing method was used to produce TiO2 nanotubes (TNTs) on Ti metal bases. These tubes were transformed into lobed nanotubes (LNTs) by heating at 6000C as scanning electron microscopy (SEM) images showed. A rapid break down anodizing (RBA) technique was utilized to produce TiO2 nanoparticles (TNPs). These particles were deposited on LNTs by the electrophoretic deposition (EPD) method. An X-ray diffraction (XRD) test revealed the polycrystalline composition of the formed LNTs and the amorphous structure of TNPs. The bioactivity of LNTs and the deposited TNPs on the LNTs were tested by immersing them in simulated body fluid (SBF) for one month. For the two samples, XRD patterns showed the appearance of small peaks of hydroxyapatite (HAp), which indicates the bioactivity of these samples. SEM images show that the HAp layer on LNTs was in the form of protrusions, while on TNPs it was in the form of crossed filaments.
{"title":"Investigation of biomimetic hydroxyapatite formation on titania nanoparticles and lobed nanotubes","authors":"Murthada Kutheir Abbas, M. S. Hashim","doi":"10.48129/kjs.18605","DOIUrl":"https://doi.org/10.48129/kjs.18605","url":null,"abstract":"An anodizing method was used to produce TiO2 nanotubes (TNTs) on Ti metal bases. These tubes were transformed into lobed nanotubes (LNTs) by heating at 6000C as scanning electron microscopy (SEM) images showed. A rapid break down anodizing (RBA) technique was utilized to produce TiO2 nanoparticles (TNPs). These particles were deposited on LNTs by the electrophoretic deposition (EPD) method. An X-ray diffraction (XRD) test revealed the polycrystalline composition of the formed LNTs and the amorphous structure of TNPs. The bioactivity of LNTs and the deposited TNPs on the LNTs were tested by immersing them in simulated body fluid (SBF) for one month. For the two samples, XRD patterns showed the appearance of small peaks of hydroxyapatite (HAp), which indicates the bioactivity of these samples. SEM images show that the HAp layer on LNTs was in the form of protrusions, while on TNPs it was in the form of crossed filaments.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"51 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"83186171","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Safi Eldein.M. Metwally, Shimaa. M. Elska, Fardous M. Zarif, Abdulla. F. Saad
The relevance of detecting aquifer characterization and aquifer potential has risen with the application of well logging techniques as the demand for water has increased. Apart from pumping data, 16 geophysical well logs (resistivity, gamma ray, self-potential, and nuclear logs) are utilized to achieve the main goal of estimating petrophysical parameters (porosity (∅), effective porosity (∅𝑒𝑓𝑓), hydraulic conductivity (k), permeability (K) and shale volume (𝑉𝑠ℎ)) of the Apollonia (Eocene fractured limestone aquifer), Upper and Lower Bahariya (Nubian sandstone aquifer) formations. The findings show that the Eocene fractured limestone aquifer has a carbonate in soft chalk with high K and ∅ as well as high k of 4974.39 mD at well ST-188 (a highly productive aquifer), whereas the Lower Bahariya formation is mostly fine to medium-grained sandstone and clay, suggesting that it formed in shallow marine environments with low K. On the other hand, Upper Bahariya was noted that having poor sand succession. As results shown, K of the most examined wells ranges from 2609.69 to 1486.812 mD at ST-258 and ST-38 wells respectively. The study appears that 𝑉𝑠ℎ, along with ∅ and K features, is regarded as an important attribute in aquifer evaluation where, estimated 𝑉𝑠ℎ over the studied area is ranges between 5.96% and 31.7% at ST-48 and WBS1 wells respectively. Overall, this study provides an important insight into the importance of evaluating groundwater aquifers over time to help in making decisions to save and protect groundwater aquifers in the future.
{"title":"Applications of well logging techniques to evaluate the groundwater aquifers in the area between southwest Bani Sweif and west Asyoute governorate, upper Egypt.","authors":"Safi Eldein.M. Metwally, Shimaa. M. Elska, Fardous M. Zarif, Abdulla. F. Saad","doi":"10.48129/kjs.17333","DOIUrl":"https://doi.org/10.48129/kjs.17333","url":null,"abstract":"The relevance of detecting aquifer characterization and aquifer potential has risen with the application of well logging techniques as the demand for water has increased. Apart from pumping data, 16 geophysical well logs (resistivity, gamma ray, self-potential, and nuclear logs) are utilized to achieve the main goal of estimating petrophysical parameters (porosity (∅), effective porosity (∅𝑒𝑓𝑓), hydraulic conductivity (k), permeability (K) and shale volume (𝑉𝑠ℎ)) of the Apollonia (Eocene fractured limestone aquifer), Upper and Lower Bahariya (Nubian sandstone aquifer) formations. The findings show that the Eocene fractured limestone aquifer has a carbonate in soft chalk with high K and ∅ as well as high k of 4974.39 mD at well ST-188 (a highly productive aquifer), whereas the Lower Bahariya formation is mostly fine to medium-grained sandstone and clay, suggesting that it formed in shallow marine environments with low K. On the other hand, Upper Bahariya was noted that having poor sand succession. As results shown, K of the most examined wells ranges from 2609.69 to 1486.812 mD at ST-258 and ST-38 wells respectively. The study appears that 𝑉𝑠ℎ, along with ∅ and K features, is regarded as an important attribute in aquifer evaluation where, estimated 𝑉𝑠ℎ over the studied area is ranges between 5.96% and 31.7% at ST-48 and WBS1 wells respectively. Overall, this study provides an important insight into the importance of evaluating groundwater aquifers over time to help in making decisions to save and protect groundwater aquifers in the future.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"126 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"78533424","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
An outbreak of COVID-19, caused by a novel virus named SARS-corona virus 2 (SARS-CoV-2), has become a global challenge which needs to be addressed immediately. It has high rate of transmission and severity of the disease varying from person to person. Researchers are trying to find effective vaccines and therapeutic targets to control this novel type of coronavirus. In the present study, surface glycoprotein was used to identify B cell and T cell epitopes that have strong immunogenic potential. Highly conserved region of the surface glycoprotein was identified from seven related human coronaviruses. Epitopes and their prominent features were predicted by using immunoinformatics tools. Epitopes which have high binding energy were joined together through linker to form an epitope-based subunit vaccine construct. Molecular docking was performed by MOE to predict the binding energies of construct with B cell receptor, MHC Class I and MHC Class II receptors. The sequence of the multi-epitope construct finally came out as LQYGSFCTQLNRGPGPGTFGAGAALQGPGPGNFTTAPAICGPGPGHWFVTQRNFAAYQYIKWPWYI. It was named as QadirVax-19. Multi-epitope construct was highly antigenic along with proteasomal cleavage sites and full population coverage. The highest binding energies were obtained which shows that the construct has the ability to produce stronger humoral and immune response against structural glycoproteins of SARS-CoV-2. In-silico cloning of the construct revealed its stable expression in E. coli. Our study suggests that reverse vaccinology approaches give the immunogenic profile of the epitopes which helped us in designing the subunit vaccine against the SARS-corona virus 2.
{"title":"QadirVax-19: A Multi Epitope-Based Vaccine against COVID-19","authors":"Misha Mukhtar, M. Qadir","doi":"10.48129/kjs.17575","DOIUrl":"https://doi.org/10.48129/kjs.17575","url":null,"abstract":"An outbreak of COVID-19, caused by a novel virus named SARS-corona virus 2 (SARS-CoV-2), has become a global challenge which needs to be addressed immediately. It has high rate of transmission and severity of the disease varying from person to person. Researchers are trying to find effective vaccines and therapeutic targets to control this novel type of coronavirus. In the present study, surface glycoprotein was used to identify B cell and T cell epitopes that have strong immunogenic potential. Highly conserved region of the surface glycoprotein was identified from seven related human coronaviruses. Epitopes and their prominent features were predicted by using immunoinformatics tools. Epitopes which have high binding energy were joined together through linker to form an epitope-based subunit vaccine construct. Molecular docking was performed by MOE to predict the binding energies of construct with B cell receptor, MHC Class I and MHC Class II receptors. The sequence of the multi-epitope construct finally came out as LQYGSFCTQLNRGPGPGTFGAGAALQGPGPGNFTTAPAICGPGPGHWFVTQRNFAAYQYIKWPWYI. It was named as QadirVax-19. Multi-epitope construct was highly antigenic along with proteasomal cleavage sites and full population coverage. The highest binding energies were obtained which shows that the construct has the ability to produce stronger humoral and immune response against structural glycoproteins of SARS-CoV-2. In-silico cloning of the construct revealed its stable expression in E. coli. Our study suggests that reverse vaccinology approaches give the immunogenic profile of the epitopes which helped us in designing the subunit vaccine against the SARS-corona virus 2.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"13 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"82221906","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Palm dates are among the most highly cultivated and consumed fruits in Kuwait and other Arabian Gulf countries. However, data on the nutritional content of Kuwaiti date fruits remain scarce. The purpose of the current study was to determine the nutritional composition and biochemical characteristics of five date palm fruit varieties at the Khalal stage grown in Kuwait. Samples of five different cultivars (Berhi (samples from 2 different locations), Ikhlas, Saamaran, and Khanizi) grown in Kuwait were analyzed for energy, protein, carbohydrates, sugars, antioxidants, and micro-minerals. Varieties studied had high energy values ranging between 351.63 kcal/100g and 368.35 kcal/100g. They were rich in potassium (4450-7128mg/100g), with significant amounts of calcium (287.8-469.1mg/100g), magnesium (130.3 -294.5 mg/100g), sodium (70.7-123.3 mg/100g), iron (2.45-3.2 mg/100g) and manganese (0.7-1.55 mg/100g). Gallic (19.97-5.47 mg/100g), chlorogenic (0-0.712mg/100 g), and ascorbic (0.624-0.875 g/1mg) acids were the main antioxidants. The data indicate that the Kuwaiti date fruit is a rich source of essential nutrients making it an important local product that requires further investigations for its nutritional properties and industrial utilization prospects.
{"title":"Nutritional composition and biochemical characteristics of five date palm fruit (Phoenix dactylifera L.) varieties at the Khalal stage grown in Kuwait.","authors":"M. Al-Hilal, Zeinab Moussa, A. Anderson","doi":"10.48129/kjs.17169","DOIUrl":"https://doi.org/10.48129/kjs.17169","url":null,"abstract":"Palm dates are among the most highly cultivated and consumed fruits in Kuwait and other Arabian Gulf countries. However, data on the nutritional content of Kuwaiti date fruits remain scarce. The purpose of the current study was to determine the nutritional composition and biochemical characteristics of five date palm fruit varieties at the Khalal stage grown in Kuwait. Samples of five different cultivars (Berhi (samples from 2 different locations), Ikhlas, Saamaran, and Khanizi) grown in Kuwait were analyzed for energy, protein, carbohydrates, sugars, antioxidants, and micro-minerals. Varieties studied had high energy values ranging between 351.63 kcal/100g and 368.35 kcal/100g. They were rich in potassium (4450-7128mg/100g), with significant amounts of calcium (287.8-469.1mg/100g), magnesium (130.3 -294.5 mg/100g), sodium (70.7-123.3 mg/100g), iron (2.45-3.2 mg/100g) and manganese (0.7-1.55 mg/100g). Gallic (19.97-5.47 mg/100g), chlorogenic (0-0.712mg/100 g), and ascorbic (0.624-0.875 g/1mg) acids were the main antioxidants. The data indicate that the Kuwaiti date fruit is a rich source of essential nutrients making it an important local product that requires further investigations for its nutritional properties and industrial utilization prospects.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"143 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"75992668","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
The aim is to compare the performances of fast regression methods, namely dimensional reduction of correlation matrix (DRCM), nonparametric dimensional reduction of correlation matrix (N-DRCM), variance inflation factor (VIF) regression, and robust VIF (R-VIF) regression in the presence of multicollinearity and outliers problems. In all simulation-scenarios, all the target variables were chosen for final models using four methods. The DRCM and N-DRCM are the methods that reach the final model in the shortest time, respectively. The time to reach the final model using R-VIF regression was approximately twice shorter than that of VIF regression. In each method, as the number of variables and the level of outliers increased, the time taken to reach the final model increased. When the level of multicollinearity and the number of variables (p > 500) increased, the times to reach the final models using DRCM in datasets with outliers were slightly shorter than the those of N-DRCM. The largest numbers of noise variables were selected to the model using DRCM and N-DRCM, but the least number of them were selected to the model using the R-VIF regression. The RMSE values obtained using DRCM, N-DRCM and VIF regression were similar in each scenario. As a result of the real dataset, the final model selected using R-VIF regression had the highest R2. It also had the lowest RMSE value among those obtained with other approaches excluding VIF regression. As such, the R-VIF regression method demonstrated a better performance than the others in all datasets.
{"title":"Comparison of fast regression algorithms in large datasets","authors":"S. Cangur, H. Ankarali","doi":"10.48129/kjs.16159","DOIUrl":"https://doi.org/10.48129/kjs.16159","url":null,"abstract":"The aim is to compare the performances of fast regression methods, namely dimensional reduction of correlation matrix (DRCM), nonparametric dimensional reduction of correlation matrix (N-DRCM), variance inflation factor (VIF) regression, and robust VIF (R-VIF) regression in the presence of multicollinearity and outliers problems. In all simulation-scenarios, all the target variables were chosen for final models using four methods. The DRCM and N-DRCM are the methods that reach the final model in the shortest time, respectively. The time to reach the final model using R-VIF regression was approximately twice shorter than that of VIF regression. In each method, as the number of variables and the level of outliers increased, the time taken to reach the final model increased. When the level of multicollinearity and the number of variables (p > 500) increased, the times to reach the final models using DRCM in datasets with outliers were slightly shorter than the those of N-DRCM. The largest numbers of noise variables were selected to the model using DRCM and N-DRCM, but the least number of them were selected to the model using the R-VIF regression. The RMSE values obtained using DRCM, N-DRCM and VIF regression were similar in each scenario. As a result of the real dataset, the final model selected using R-VIF regression had the highest R2. It also had the lowest RMSE value among those obtained with other approaches excluding VIF regression. As such, the R-VIF regression method demonstrated a better performance than the others in all datasets.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"29 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"88813672","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Dielectric ceramic materials are well-recognized in the semiconductor industry because of their exceptional thermal stability, chemical resistance, and crystallinity. Despite their potential applications, these are also demanded in wireless communication. This paper reports the structural, morphological, and dielectric properties of sol-gel-derived CaZnAl2O4 ceramic nanoparticles. X-ray diffraction (XRD) analysis exhibited the polycrystalline characteristic of the CaZnAl2O4 nanoparticles with their crystallite size of 13 nm. Fourier-Transform infrared spectroscopy (FTIR) analysis confirmed the relevant vibration peaks of various functional groups present in the ceramic nanoparticles. Surface morphology study demonstrated the preparation of spherical grains with their mean diameter of 16 nm. The concentric rings also confirm the crystallinity of the nanoparticles that appeared in the selected area diffraction pattern. Furthermore, dielectric properties investigation showed the variation of dielectric permittivity from 23.76 to 21.67 as a function of increased frequency. Similarly, the dielectric loss is found to decrease from 0.047 to 0.039. As a result, the conductivity increased from 1.324 μS/m to 3.639 μS/m as a function of applied frequency.
{"title":"Sol-gel Synthesis of CaZnAl2O4 Ceramic Nanoparticles and Investigation of their Properties","authors":"Sekhar Didde, Dubey R. S., S. Panda","doi":"10.48129/kjs.17809","DOIUrl":"https://doi.org/10.48129/kjs.17809","url":null,"abstract":"Dielectric ceramic materials are well-recognized in the semiconductor industry because of their exceptional thermal stability, chemical resistance, and crystallinity. Despite their potential applications, these are also demanded in wireless communication. This paper reports the structural, morphological, and dielectric properties of sol-gel-derived CaZnAl2O4 ceramic nanoparticles. X-ray diffraction (XRD) analysis exhibited the polycrystalline characteristic of the CaZnAl2O4 nanoparticles with their crystallite size of 13 nm. Fourier-Transform infrared spectroscopy (FTIR) analysis confirmed the relevant vibration peaks of various functional groups present in the ceramic nanoparticles. Surface morphology study demonstrated the preparation of spherical grains with their mean diameter of 16 nm. The concentric rings also confirm the crystallinity of the nanoparticles that appeared in the selected area diffraction pattern. Furthermore, dielectric properties investigation showed the variation of dielectric permittivity from 23.76 to 21.67 as a function of increased frequency. Similarly, the dielectric loss is found to decrease from 0.047 to 0.039. As a result, the conductivity increased from 1.324 μS/m to 3.639 μS/m as a function of applied frequency.","PeriodicalId":49933,"journal":{"name":"Kuwait Journal of Science & Engineering","volume":"87 1","pages":""},"PeriodicalIF":0.0,"publicationDate":"2022-04-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"75008261","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":0,"RegionCategory":"","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
京公网安备 11010802042870号
京ICP备2023020795号-1
扫码关注我们
求助内容：
应助结果提醒方式：